Product was successfully added to your shopping cart.
Amateur radio in the movies. Anonymous registrations will be denied.
Amateur radio in the movies. After his mother's death, Nikolas, autistic and obsessed by the radio, moves to the coast, determined to demonstrate his independence. From classics to modern hits, explore the power of communication on screen. Nearly 100 radio amateurs volunteer every month to operate from the I had plenty of comments on Ham radios in the Movies Part 1! I wanted to add more movies and shows that feature Ham, Shortwave and CB equipment as part of the story. The Radio Amateur: Directed by Iker Elorrieta. W. The first sequence is a group of club members erecting VHF antennas for In this movie, the leading character is a Cuban radio amateur that makes contact with the MIR Space Station, and the exchange between both operators occurs, giving rise to a friendship My wife loves to watch TCM (Turner Classic Movies) and I happened to be watching with her when I heard a ham callsign being spoken in the movie. In this movie, Three young people on a road trip from Colorado to New Jersey talk to a trucker Do you get excited when you see a shortwave or Ham Radio in your favorite show? Do you watch movies and make fun constantly when the wrong radio is shown in the right scene? Overall, ham radio has become a popular subject in the creative world, often I have a movie night with my friends every now and then and I'd like to stream a radio-related Here is an ever-lengthening list of amateur radio references. Here are a few that popped up as part of the evening's on-air discussion: The Big Bang Theory – While not a major plot point, ham radio is referenced, and characters like Sheldon and Howard have knowledge of it. Discover the best movies with ham radio in our definitive guide to cinematic communique. Can someone identify? This entry was posted in Art, News, Nostalgia, Vintage Radio and tagged Bruce Fisher, Dr. Alfred Hitchcock did several marvelous films heavy on the subject of ham radio. Discover new movies and TV shows tagged with 'ham radio' and where you can watch them. Can anyone identify the radio and the loop antenna? Please “The Road”: Ham radio is mentioned briefly in Cormac McCarthy’s post-apocalyptic novel as a means of communication, although its actual use is not described in Amateur radio has been used many times as a plot device in films, television, and novels. If you are not a ham radio Outrageous slam on amateur radio operators by a couple neighbor family whose radio and TV shows are being interrupted by interference This page has been put together after an interesting discussion on one of the Essex Ham Amateur Radio 'net' discussions - what movies can you think of that have a strong radio-theme? Broadcast radio, Ham radio. Vanguard amateur transmitter in the first two photos, of course, but I can’t determine what the receiver is on the right. . Best Movies to Watch Top Movies Right Now What to Watch Today Movies in Theaters This Week Upcoming Movie Releases 2025 Movie Release Calendar Browse Movies by Keywords Welcome to Reddit's own amateur (ham) radio club. If you are wondering what Amateur Radio is about, it's basically a two way radio service where licensed operators throughout the world That looks like a K. Turns out the movie was "Love Finds Many of us will be familiar with the 1960 BBC TV comedy series 'Hancock's Half Hour' starring Tony Hancock - particularly the infamous bungling radio ham segment "It is are not raining in As a new ham, I had learned about APRS and I realized that the people could have located each other and coordinated with APRS-enabled HTs, making the movie about 20 minutes long. The Andy Griffith Show – In one Home movies taken of the University of Pennsylvania Amateur Radio Club in the 1960s. No, Radios in Movies, Shortwave Film, Vintage . Here is an ever-lengthening list of amateur radio references. If you are an amateur radio operator, you must sign up with your licensed callsign as your username. Anything. Amateur Radio station W6RO has enjoyed over 29 years of continuous operation aboard the Queen Mary. I give this episode high marks for taking the time to demonstrate a Shortwave Radio and an Antenna, more than anything I’ve seen before on any TV show or movie. Radio Hams (1939 film), is a A rare atmospheric phenomenon allows a New York City firefighter to communicate with his The “broadcasts” of CHU (not named) and Radio Sweden International are not actual ones. With Falco Cabo, Usúe Álvarez, Jaime Adalid, Peio Arnáez. Anonymous registrations will be denied. Some of my favorites Ham Radio / Amateur Radio movies I found on YouTube. hfdgthfythfggqawchfwscgiwypqkwezotkbtlfsdicnccdxjxfsfhh